Iright
BRAND / VENDOR: Proteintech

Proteintech, 81202-2-RR, mCherry Recombinant monoclonal antibody

CATALOG NUMBER: 81202-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ul The mCherry (81202-2-RR) by Proteintech is a Recombinant antibody targeting mCherry in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to recombinant protein samples 81202-2-RR targets mCherry in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with recombinant protein samples. Tested Applications Positive WB detected in: Transfected HEK-293T cells Positive IF/ICC detected in: Transfected HEK-293 cells Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Red fluorescent proteins (RFPs) is a collective term referring to a heterogeneous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages. The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitating visualization of subcellular localization through fluorescence microscopy. This antibody is a rabbit polyclonal antibody raised against mCherry. Specification Tested Reactivity: recombinant protein Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species Full Name: mCherry Calculated Molecular Weight: 27 kDa Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924