Iright
BRAND / VENDOR: Proteintech

Proteintech, 81225-1-RR, GRB10 Recombinant monoclonal antibody

CATALOG NUMBER: 81225-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GRB10 (81225-1-RR) by Proteintech is a Recombinant antibody targeting GRB10 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 81225-1-RR targets GRB10 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, NIH/3T3 cells, HSC-T6 cells Positive IF/ICC detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information GRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation. GRB10 has 4 isoforms with the molecular mass of 60-70 kDa, which are produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20355 Product name: Recombinant human GRB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC024285 Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI Predict reactive species Full Name: growth factor receptor-bound protein 10 Calculated Molecular Weight: 536aa,61 kDa; 594aa,67 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC024285 Gene Symbol: GRB10 Gene ID (NCBI): 2887 RRID: AB_2923710 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13322 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924