Iright
BRAND / VENDOR: Proteintech

Proteintech, 81347-2-RR, IKKB Recombinant monoclonal antibody

CATALOG NUMBER: 81347-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IKKB (81347-2-RR) by Proteintech is a Recombinant antibody targeting IKKB in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 81347-2-RR targets IKKB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, THP-1 cells, A-673 cells, Jurkat cells, PC-12 cells, NIH/3T3 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IKBKB, also named as IKKB, IKK2, NFKBIKB and IKK-B, belongs to the protein kinase superfamily, Ser/Thr protein kinase family and I-kappa-B kinase subfamily. IKBKB is a Serine kinase that plays an essential role in the NF-kappa-B signaling pathway. It acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. In addition to the NF-kappa-B inhibitors, IKBKB phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. It also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, IKBKB acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8191 Product name: Recombinant human IKBKB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC006231 Sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS Predict reactive species Full Name: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta Calculated Molecular Weight: 756aa,81 kDa; 256aa,29 kDa Observed Molecular Weight: 80-85 kDa GenBank Accession Number: BC006231 Gene Symbol: IKBKB Gene ID (NCBI): 3551 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14920 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924