Iright
BRAND / VENDOR: Proteintech

Proteintech, 81463-1-RR, GLUT1 Recombinant monoclonal antibody

CATALOG NUMBER: 81463-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GLUT1 (81463-1-RR) by Proteintech is a Recombinant antibody targeting GLUT1 in WB, IHC, ELISA applications with reactivity to human samples 81463-1-RR targets GLUT1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: unboiled HEK-293 cells, 37°C incubated HeLa cells Positive IHC detected in: human skin cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information GLUT1, also known as SLC2A1, is a ubiquitously expressed glucose transporter and is responsible for the basal level of glucose uptake in most cell types. Human erythrocytes express the highest level of GLUT1. Defects in SLC2A1 are the cause of GLUT1 deficiency syndrome type 1 and type 2. High expression of GLUT1 has been reported to be a reliable immunohistochemical marker for juvenile hemangiomas. GLUT1 protein may appear as two or more distinct forms among 43 kDa to 55 kDa due to the different glycosylation states. And the conversion of the highly glycosylated form of GLUT1 to a less glycosylated form has been reported to correlate with differentiation (PMID: 8263524, 23302780). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16282 Product name: Recombinant human SLC2A1,GLUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 216-280 aa of BC121804 Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 1 Calculated Molecular Weight: 492 aa, 54 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC121804 Gene Symbol: GLUT1 Gene ID (NCBI): 6513 RRID: AB_2923718 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11166 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924