Iright
BRAND / VENDOR: Proteintech

Proteintech, 81468-5-RR, SCD1 Recombinant monoclonal antibody

CATALOG NUMBER: 81468-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SCD1 (81468-5-RR) by Proteintech is a Recombinant antibody targeting SCD1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 81468-5-RR targets SCD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species Full Name: stearoyl-CoA desaturase (delta-9-desaturase) Calculated Molecular Weight: 355 aa, 41 kDa Observed Molecular Weight: 28-42 kDa GenBank Accession Number: BC005807 Gene Symbol: SCD Gene ID (NCBI): 6319 RRID: AB_3670496 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00767 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924