Proteintech, 81482-1-RR, Caspase 1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Caspase 1 (81482-1-RR) by Proteintech is a Recombinant antibody targeting Caspase 1 in WB, ELISA applications with reactivity to human samples 81482-1-RR targets Caspase 1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, THP-1 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 81482-1-RR can recognize the 45 kDa Pro-Caspase1 and the 30-35 kDa splicing isoforms or active dimer form of caspase 1. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11143 Product name: Recombinant human Caspase 1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-311 aa of BC062327 Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH Predict reactive species Full Name: caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) Calculated Molecular Weight: 404 aa, 45 kDa Observed Molecular Weight: 30 kDa, 35 kDa, 43-45 kDa GenBank Accession Number: BC062327 Gene Symbol: Caspase 1 Gene ID (NCBI): 834 RRID: AB_2935555 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29466 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.