Proteintech, 81527-1-RR, GSTK1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GSTK1 (81527-1-RR) by Proteintech is a Recombinant antibody targeting GSTK1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 81527-1-RR targets GSTK1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, L02 cells, Raji cells, Daudi cells Positive IHC detected in: mouse testis tissue, mouse liver tissue, human pancreas cancer tissue, human lung cancer tissue, human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GSTK1, glutathione S-transferase kappa 1, belongs to the superfamily of glutathione S-transferase (GST), which is related to oxidative stress (PMID:16081649). GSTK1 expression is negatively correlated with obesity and hypertrophic cardiomyopathy (PMID:21428694, PMID:27378925). GSTK1 was expressed in the peroxisomal and mitochondrial fractions and localized to peroxisomes (PubMed:14742434). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6036 Product name: Recombinant human GSTK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC050715 Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL Predict reactive species Full Name: glutathione S-transferase kappa 1 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC050715 Gene Symbol: GSTK1 Gene ID (NCBI): 373156 RRID: AB_2935559 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y2Q3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.