Proteintech, 81778-1-RR, PROX1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PROX1 (81778-1-RR) by Proteintech is a Recombinant antibody targeting PROX1 in WB, IF/ICC, ELISA applications with reactivity to human samples 81778-1-RR targets PROX1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, SH-SY5Y cells Positive IF/ICC detected in: HuH-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:650-1:2600 Background Information PROX1, Prospero homeobox protein 1, belongs to the Prospero homeobox family and contain a Prospero-type homeobox DNA-binding domain. PROX1 plays a fundamental role in early development of CNS and regulates the expression of gene and development of postmitotic, undifferentiated neurons. Also, PROX1 is a required regulator of the development of the lymphatic system. This antibody is raised against part of C-terminal chain of human PROX1. The calculated molecular weight of PROX1 is 83 kDa, but with post-translational modifications, PROX1 is about 90 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1543 Product name: Recombinant human PROX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-736 aa of BC024201 Sequence: TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH Predict reactive species Full Name: prospero homeobox 1 Calculated Molecular Weight: 737 aa, 83 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC024201 Gene Symbol: PROX1 Gene ID (NCBI): 5629 RRID: AB_2935579 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.