Proteintech, 81798-1-RR, ATF4 Recombinant monoclonal antibody

Size: 20ul / 100ul The ATF4 (81798-1-RR) by Proteintech is a Recombinant antibody targeting ATF4 in WB, IHC, IP, ELISA, ChIP-qPCR applications with reactivity to human, mouse samples 81798-1-RR targets ATF4 in WB, IHC, IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, MG132 treated HEK-293 cells, MG132 treated HeLa cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissue, human stomach cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive ChIP-qPCR detected in: Tunicamycin (2ug/mll) overnight NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation[PMID: 19016586]. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies[PMID: 19726872]. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia[PMID: 18163433]. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer. Endogenous ATF4 protein has a molecular mass of 50kd. [PMID: 17726049]. ATF4 can bind DNA as a homodimer and as a heterodimer. ATF4 is ubiquitinated by SCF(BTRC) in response to mTORC1 signal, followed by proteasomal degradation and leading to down-regulate expression of SIRT4, so the molecular weight of ATF4 may be 70 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1279 Product name: Recombinant human ATF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC022088 Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP Predict reactive species Full Name: activating transcription factor 4 (tax-responsive enhancer element B67) Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC022088 Gene Symbol: ATF4 Gene ID (NCBI): 468 RRID: AB_2935580 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18848 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.