Proteintech, 81899-1-RR, STX17 Recombinant monoclonal antibody

Size: 20ul / 100ul The STX17 (81899-1-RR) by Proteintech is a Recombinant antibody targeting STX17 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 81899-1-RR targets STX17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HepG2 cells, HEK-293 cells, L02 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for the fusion of cellular membranes. Syntaxin 17 (STX17) is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. STX17 may also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi and/or regulate transport between the endoplasmic reticulum, the ERGIC and the Golgi. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12134 Product name: Recombinant human STX17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC111009 Sequence: MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCGIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEE Predict reactive species Full Name: syntaxin 17 Calculated Molecular Weight: 302 aa, 33 kDa Observed Molecular Weight: 33-35 kD GenBank Accession Number: BC111009 Gene Symbol: STX17 Gene ID (NCBI): 55014 RRID: AB_2935590 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56962 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.