Iright
BRAND / VENDOR: Proteintech

Proteintech, 81963-1-RR, LDHB Recombinant monoclonal antibody

CATALOG NUMBER: 81963-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LDHB (81963-1-RR) by Proteintech is a Recombinant antibody targeting LDHB in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 81963-1-RR targets LDHB in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, DU 145 cells, rat heart tissue, mouse brain tissue, rat brain tissue Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of pyruvate and NADH to lactate and NAD+ in the glycolytic pathway. LDH comprises LDHA and LDHB, two subunits that are encoded by independent genes. In muscle or liver, most of the LDH is composed of four LDHA subunits, and preferably catalyzes the reduction of pyruvate to lactate. In heart and brain, LDH is mainly composed of four LDHB subunits, and predominantly catalyzes the oxidation of lactate to pyruvate. In other tissues, LDH is composed of both LDHA and LDHB. (PMID: 26269128, 31804482) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6605 Product name: Recombinant human LDHB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-334 aa of BC002362 Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL Predict reactive species Full Name: lactate dehydrogenase B Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC002362 Gene Symbol: LDHB Gene ID (NCBI): 3945 RRID: AB_2935594 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07195 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924