Iright
BRAND / VENDOR: Proteintech

Proteintech, 82061-1-RR, GSK3B Recombinant monoclonal antibody

CATALOG NUMBER: 82061-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GSK3B (82061-1-RR) by Proteintech is a Recombinant antibody targeting GSK3B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 82061-1-RR targets GSK3B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, A549 cells, Jurkat cells, PC-12 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:225-1:900 Background Information Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase.GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation. In skeletal muscle, it contributes to INS regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species Full Name: glycogen synthase kinase 3 beta Calculated Molecular Weight: 433 aa, 48 kDa Observed Molecular Weight: ~45 kDa GenBank Accession Number: BC000251 Gene Symbol: GSK3B Gene ID (NCBI): 2932 RRID: AB_3086460 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49841 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924