Proteintech, 82128-1-RR, USP14 Recombinant monoclonal antibody

Size: 20ul / 100ul The USP14 (82128-1-RR) by Proteintech is a Recombinant antibody targeting USP14 in WB, IP, ELISA applications with reactivity to Human, mouse, rat samples 82128-1-RR targets USP14 in WB, IP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HEK-293T cells, DU 145 cells, Jurkat cells, NIH/3T3 cells, C6 cells Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information USP14(Ubiquitin carboxyl-terminal hydrolase 14) is also named as TGT and belongs to the peptidase C19 family. Mammalian USP14 is unique among known UBP enzymes in that it is activated catalytically upon specific association with the 26S proteasome. USP14 inhibition accelerated the degradation of oxidized proteins and enhanced resistance to oxidative stress. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5979 Product name: Recombinant human USP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC003556 Sequence: MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL Predict reactive species Full Name: ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC003556 Gene Symbol: USP14 Gene ID (NCBI): 9097 RRID: AB_3086466 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54578 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.