Iright
BRAND / VENDOR: Proteintech

Proteintech, 82137-1-RR, DHX15 Recombinant monoclonal antibody

CATALOG NUMBER: 82137-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DHX15 (82137-1-RR) by Proteintech is a Recombinant antibody targeting DHX15 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 82137-1-RR targets DHX15 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-251 cells, HeLa cells, U2OS cells, A431 cells, NIH/3T3 cells, C6 cells Positive IP detected in: NIH/3T3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information DHX15, also named as DBP1 and DDX15, is a DExD/H-box protein that has been identified in spliceosome, through its carboxyl (C)-terminal G-patch domain and stimulates the helicase activity of DHX15. DHX15 is a pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA. The MW of DHX15 is about 90-95kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2895 Product name: Recombinant human DHX15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-517 aa of BC035974 Sequence: TDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL Predict reactive species Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 15 Calculated Molecular Weight: 795 aa, 91 kDa Observed Molecular Weight: 90-95 kDa GenBank Accession Number: BC035974 Gene Symbol: DHX15 Gene ID (NCBI): 1665 RRID: AB_3086467 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43143 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924