Iright
BRAND / VENDOR: Proteintech

Proteintech, 82191-3-RR, IL-10 Recombinant monoclonal antibody

CATALOG NUMBER: 82191-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-10 (82191-3-RR) by Proteintech is a Recombinant antibody targeting IL-10 in WB, ELISA applications with reactivity to mouse samples 82191-3-RR targets IL-10 in WB, IHC, IF, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information IL-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. Specification Tested Reactivity: mouse Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0026 Product name: Recombinant Mouse IL-10 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 19-178 aa of NM_010548 Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS Predict reactive species Full Name: interleukin 10 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: NM_010548 Gene Symbol: Il10 Gene ID (NCBI): 16153 RRID: AB_3670518 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18893 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924