Proteintech, 82210-1-RR, SIRT3 Recombinant monoclonal antibody

Size: 20ul / 100ul The SIRT3 (82210-1-RR) by Proteintech is a Recombinant antibody targeting SIRT3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 82210-1-RR targets SIRT3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, rat heart tissue, HepG2 cells, HT-29 cells, mouse liver tissue, pig liver tissue, rat liver tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Sirtuins are NAD+-dependent histone/protein deacetylases (HDAC) and SIRT3 is the only sirtuin whose increased expression has been shown to correlate with an extended life span in humans. It is localized in the mitochondrial matrix, where it regulates the acetylation levels of metabolic enzymes, including acetyl coenzyme A synthetase 2. SIRT3 is stress-responsive and its increased expression protects myocytes from genotoxic and oxidative stress-mediated cell death. full-length hSIRT3 (44 kDa) is an inert protein and that it is activated inside the mitochondria following deletion of 142 amino acids of the N-terminal segment. This processed form of SIRT3 is approximately 28 kDa and possesses deacetylase activity. The full SIRT3 is a 44 kDa protein and is processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26280 Product name: Recombinant human SIRT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 202-399 aa of BC001042 Sequence: GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK Predict reactive species Full Name: sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC001042 Gene Symbol: SIRT3 Gene ID (NCBI): 23410 RRID: AB_3086470 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NTG7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.