Proteintech, 82453-2-RR, NLRP3 Recombinant monoclonal antibody

Size: 20ul / 100ul The NLRP3 (82453-2-RR) by Proteintech is a Recombinant antibody targeting NLRP3 in WB, ELISA applications with reactivity to human, mouse samples 82453-2-RR targets NLRP3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LPS treated RAW 264.7 cells, LPS treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death(PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26289 Product name: Recombinant human NLRP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 937-1036 aa of NM_001079821 Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW Predict reactive species Full Name: NLR family, pyrin domain containing 3 Calculated Molecular Weight: 118 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: NM_001079821 Gene Symbol: NLRP3 Gene ID (NCBI): 114548 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96P20 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.