Iright
BRAND / VENDOR: Proteintech

Proteintech, 82551-2-RR, FABP5 Recombinant monoclonal antibody

CATALOG NUMBER: 82551-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FABP5 (82551-2-RR) by Proteintech is a Recombinant antibody targeting FABP5 in WB, ELISA applications with reactivity to human samples 82551-2-RR targets FABP5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, A431 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3005 Product name: Recombinant human FABP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC019385 Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Predict reactive species Full Name: fatty acid binding protein 5 (psoriasis-associated) Calculated Molecular Weight: 135 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC019385 Gene Symbol: FABP5 Gene ID (NCBI): 2171 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q01469 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924