Proteintech, 82671-1-RR, FNDC5 Recombinant monoclonal antibody

Size: 20ul / 100ul The FNDC5 (82671-1-RR) by Proteintech is a Recombinant antibody targeting FNDC5 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig samples 82671-1-RR targets FNDC5 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HepG2 cells, C2C12 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, pig skeletal muscle tissue, mouse stomach tissue, rat stomach tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information fibronectin type III domain containing 5(FNDC5) encodes 23 kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure. Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29714 Product name: Recombinant human FNDC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-153 aa of BC062297 Sequence: IIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW Predict reactive species Full Name: fibronectin type III domain containing 5 Calculated Molecular Weight: 212 aa, 24 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC062297 Gene Symbol: FNDC5 Gene ID (NCBI): 252995 RRID: AB_3086499 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NAU1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.