Iright
BRAND / VENDOR: Proteintech

Proteintech, 82673-2-RR, MFN2 Recombinant monoclonal antibody

CATALOG NUMBER: 82673-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MFN2 (82673-2-RR) by Proteintech is a Recombinant antibody targeting MFN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 82673-2-RR targets MFN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mitofusin-2 (MFN2), a mitochondrial membrane protein, is a dynamin-like GTPase embedded in the outer mitochondrial membrane (OMM) which plays a central role in regulating mitochondrial fusion and cell metabolism (PMID: 35399520; 34026850). There are two human mitofusin isoforms MFN1 and MFN2, MFN1 and MFN2 mediate outer membrane fusion, OPA1 is involved in inner membrane fusion, and DRP1 is responsible for mitochondrial fission (PMID: 17084350; 35399520). It has been shown that MFN2 participates in multiple cellular biological processes under physical and pathological conditions. Apart from mitochondria fusion, MFN2 is also involved in mitochondrial-ER contacts (MERCs), mitophagy, cellular apoptosis, and proliferation (PMID: 34026850). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2845 Product name: Recombinant human MFN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-353 aa of BC017061 Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA Predict reactive species Full Name: mitofusin 2 Calculated Molecular Weight: 757 aa, 86 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC017061 Gene Symbol: MFN2 Gene ID (NCBI): 9927 ENSEMBL Gene ID: ENSG00000116688 RRID: AB_3086501 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95140 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924