Iright
BRAND / VENDOR: Proteintech

Proteintech, 82848-3-RR, CHRNA7 (48 kDa) Recombinant monoclonal antibody

CATALOG NUMBER: 82848-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CHRNA7 (48 kDa) (82848-3-RR) by Proteintech is a Recombinant antibody targeting CHRNA7 (48 kDa) in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 82848-3-RR targets CHRNA7 (48 kDa) in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, Jurkat cells Positive IHC detected in: mouse brain tissue, rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Nicotinic acetylcholine receptors (nAChRs) are cholinergic receptors that form ligand-gated ion channels that mediate fast signal transmission at synapses. CHRNA7 (neuronal acetylcholine receptor subunit alpha-7) forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. CHRNA7, so that like CHRNA7, the epithelial CHRFAM7A ORF encodes a protein (48 kDa) that differs from the CHRNA7 (58 kDa) by a distinct amino terminus and molecular weight.(PMID: 25473097) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15980 Product name: Recombinant human CHRNA7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 130-321 aa of BC037571 Sequence: TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA Predict reactive species Full Name: cholinergic receptor, nicotinic, alpha 7 Calculated Molecular Weight: 502 aa, 56 kDa Observed Molecular Weight: ~50 kDa GenBank Accession Number: BC037571 Gene Symbol: CHRNA7 Gene ID (NCBI): 1139 RRID: AB_3670574 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924