Iright
BRAND / VENDOR: Proteintech

Proteintech, 82852-3-RR, MAZ Recombinant monoclonal antibody

CATALOG NUMBER: 82852-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MAZ (82852-3-RR) by Proteintech is a Recombinant antibody targeting MAZ in IHC, IF/ICC, ELISA applications with reactivity to human samples 82852-3-RR targets MAZ in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Myc-associated zinc-finger protein (MAZ) is a transcription factor with dual roles in transcription initiation and termination. MAZ can activate the expression of a variety of genes such as the c-Myc, insulin, VEGF, and RAS gene family and the serotonin 1A receptor. MAZ plays a critical role in the progression of various cancers including breast, prostate, liver, and so on. Deregulation of MAZ expression is associated with the progression of pancreatic ductal adenocarcinoma (PDAC)(PMID: 29414775). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15200 Product name: Recombinant human MAZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC041629 Sequence: MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG Predict reactive species Full Name: MYC-associated zinc finger protein (purine-binding transcription factor) Calculated Molecular Weight: 477 aa, 49 kDa Observed Molecular Weight: 49-51 kDa GenBank Accession Number: BC041629 Gene Symbol: MAZ Gene ID (NCBI): 4150 RRID: AB_3086554 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924