Iright
BRAND / VENDOR: Proteintech

Proteintech, 82862-6-RR, IL-15 Recombinant monoclonal antibody

CATALOG NUMBER: 82862-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-15 (82862-6-RR) by Proteintech is a Recombinant antibody targeting IL-15 in WB, ELISA applications with reactivity to mouse samples 82862-6-RR targets IL-15 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, A20 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2179 Product name: Recombinant mouse IL-15 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 49-162 aa of NM_001254747 Sequence: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS Predict reactive species Full Name: interleukin 15 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: NM_001254747 Gene Symbol: IL-15 Gene ID (NCBI): 16168 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48346 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924