Proteintech, 82893-2-RR, MELK Recombinant monoclonal antibody

Size: 20ul / 100ul The MELK (82893-2-RR) by Proteintech is a Recombinant antibody targeting MELK in WB, IHC, ELISA applications with reactivity to Human, mouse samples 82893-2-RR targets MELK in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: NCCIT cells, HepG2 cells, MCF-7 cells, MDA-MB-231 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MELK is involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. It also plays a key role in cell proliferation and carcinogenesis, and it is required for proliferation of embryonic and postnatal multipotent neural progenitors. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1897 Product name: Recombinant human MELK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-651 aa of BC014039 Sequence: EDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV Predict reactive species Full Name: maternal embryonic leucine zipper kinase Calculated Molecular Weight: 651 aa, 75 kDa Observed Molecular Weight: 50-70 kDa GenBank Accession Number: BC014039 Gene Symbol: MELK Gene ID (NCBI): 9833 RRID: AB_3670619 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14680 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.