Proteintech, 82898-2-RR, KPNA4 Recombinant monoclonal antibody

Size: 20ul / 100ul The KPNA4 (82898-2-RR) by Proteintech is a Recombinant antibody targeting KPNA4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 82898-2-RR targets KPNA4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, Jurkat cells, NIH/3T3 cells, mouse ovary tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information KPNA4, also named importin subunit alpha-3, karyopherin-alpha4, is a cytoplasmic protein that recognizes nuclear localization signals (NLSs) and dock NLS-containing proteins to the nuclear pore complex. Nuclear import, mediated in part by karyopherin-α (KPNA)/importin-α subtypes, regulates transcription factor access to the genome and determines cell fate. KPNA4-mediated nuclear transport of Ras-responsive element-binding protein (RREB1), which sustains Ras/ERK pathway signaling through repressing miR-143/145 expression (PMID: 31822798). KPNA4 is one of the main isoforms that is activated in many human cancers. KPNA4 expression was elevated in head and neck of squamous cell carcinoma (PMID: 33188837). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3133 Product name: Recombinant human KPNA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC034493 Sequence: MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL Predict reactive species Full Name: karyopherin alpha 4 (importin alpha 3) Calculated Molecular Weight: 521 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC034493 Gene Symbol: KPNA4 Gene ID (NCBI): 3840 RRID: AB_3670627 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.