Iright
BRAND / VENDOR: Proteintech

Proteintech, 82931-1-RR, KHSRP Recombinant monoclonal antibody

CATALOG NUMBER: 82931-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The KHSRP (82931-1-RR) by Proteintech is a Recombinant antibody targeting KHSRP in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 82931-1-RR targets KHSRP in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, Jurkat cells, mouse spleen tissue, mouse brain tissue, rat brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information KHSRP, also named as FUBP2, KSRP, and p75, belongs to the KHSRP family. It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possi3bly by recruiting degradation machinery to ARE-containing mRNAs. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33890 Product name: Recombinant human KHSRP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-710 aa of NM_003685 Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ Predict reactive species Full Name: KH-type splicing regulatory protein Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_003685 Gene Symbol: KHSRP Gene ID (NCBI): 8570 RRID: AB_3670669 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92945 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924