Iright
BRAND / VENDOR: Proteintech

Proteintech, 82932-1-RR, OS9 Recombinant monoclonal antibody

CATALOG NUMBER: 82932-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The OS9 (82932-1-RR) by Proteintech is a Recombinant antibody targeting OS9 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 82932-1-RR targets OS9 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HUVEC cells, U2OS cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information OS-9 is a ubiquitously expressed ensoplasmic reticulum (ER)-associated protein originally identified as being amplified in certain osteosarcomas. It functions in ER quality control and ER-associated degradation (ERAD). There are three isoforms of this protein: OS-9.1, OS-9.2 and OS-9.3. The longest isoform, OS-9.1, contains 667 aa, OS-9.2 lacks aa 535-589, whereas OS-9.3 lacks aa 456-470 and 535-589. OS-9.1 and OS-9.2 are N-glycosylated, ubiquitously expressed in human tissues, and amplified in tumors. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0106 Product name: Recombinant human OS9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-435 aa of BC000532 Sequence: GRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGE Predict reactive species Full Name: osteosarcoma amplified 9, endoplasmic reticulum associated protein Calculated Molecular Weight: 76 kDa Observed Molecular Weight: 83-97 kDa GenBank Accession Number: BC000532 Gene Symbol: OS9 Gene ID (NCBI): 10956 RRID: AB_3670673 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13438 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924