Proteintech, 82940-1-RR, CAMP Recombinant monoclonal antibody

Size: 20ul / 100ul The CAMP (82940-1-RR) by Proteintech is a Recombinant antibody targeting CAMP in WB, ELISA applications with reactivity to human, mouse samples 82940-1-RR targets CAMP in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human saliva, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:2000 Background Information CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species. Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2622 Product name: Recombinant human CAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC055089 Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Predict reactive species Full Name: cathelicidin antimicrobial peptide Calculated Molecular Weight: 170 aa, 19 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC055089 Gene Symbol: CAMP Gene ID (NCBI): 820 RRID: AB_3670682 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49913 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.