Proteintech, 82957-2-RR, FDX1 Recombinant monoclonal antibody

Size: 20ul / 100ul The FDX1 (82957-2-RR) by Proteintech is a Recombinant antibody targeting FDX1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82957-2-RR targets FDX1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, PC-3 cells, U-87 MG cells, U-251 cells, HK-2 cells Positive IHC detected in: human stomach cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: A431 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information FDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acids. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3301 Product name: Recombinant human FDX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC017063 Sequence: MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Predict reactive species Full Name: ferredoxin 1 Calculated Molecular Weight: 184 aa, 19 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC017063 Gene Symbol: FDX1 Gene ID (NCBI): 2230 RRID: AB_3670701 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.