Proteintech, 82959-1-RR, SCN3B Recombinant monoclonal antibody

Size: 20ul / 100ul The SCN3B (82959-1-RR) by Proteintech is a Recombinant antibody targeting SCN3B in WB, ELISA applications with reactivity to human, mouse, rat samples 82959-1-RR targets SCN3B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat brain tissue, mouse brain tissue, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The sodium voltage-gated channel beta subunit 3 (SCN3B) plays a crucial role in electrically excitable cells and conduction tissue in the heart. Some previous studies have established that genetic modification in sodium voltage-channel genes encoding for the cardiac β-subunits, such as SCN1B, SCN2B, SCN3B and SCN4B, can result in atrial fibrillation (AF). (PMID: 36362949) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23201 Product name: Recombinant human SCN3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-93 aa of BC126265 Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ Predict reactive species Full Name: sodium channel, voltage-gated, type III, beta Observed Molecular Weight: 29 kDa GenBank Accession Number: BC126265 Gene Symbol: SCN3B Gene ID (NCBI): 55800 RRID: AB_3670703 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NY72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.