Iright
BRAND / VENDOR: Proteintech

Proteintech, 82959-7-RR, SCN3B Recombinant monoclonal antibody

CATALOG NUMBER: 82959-7-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SCN3B (82959-7-RR) by Proteintech is a Recombinant antibody targeting SCN3B in WB, ELISA applications with reactivity to human, mouse, rat samples 82959-7-RR targets SCN3B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat brain tissue, mouse brain tissue, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The sodium channel is a multi-subunit protein complex composed of a single large α-subunit along with smaller additional β-subunits. There are at least three different β-subunit genes, SCN1b, SCN2b, and SCN3b, all of which are expressed widely in excitable tissues. The bands on Western blots for SCN3b (45-50 kDa) were significantly larger than the predicted molecular weight, which is consistent with the protein being glycosylated. The two bands on the Western blot could be due to different levels of glycosylation or alternative spliced isoforms. (PMID: 11744748) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23201 Product name: Recombinant human SCN3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-93 aa of BC126265 Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ Predict reactive species Full Name: sodium channel, voltage-gated, type III, beta Observed Molecular Weight: 28 kDa GenBank Accession Number: BC126265 Gene Symbol: SCN3B Gene ID (NCBI): 55800 RRID: AB_3670704 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NY72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924