Product Description
Size: 20ul / 100ul
The ACAP1 (82967-4-RR) by Proteintech is a Recombinant antibody targeting ACAP1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples
82967-4-RR targets ACAP1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells
Positive IF/ICC detected in: Jurkat cells
Positive FC (Intra) detected in: A431 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Background Information
ACAP1, also named as Centaurin-beta-1, is a 740 amino acid protein, which is expressed Highly in lung and spleen. ACAP1 as a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) is required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface and required for regulated export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag34309 Product name: Recombinant human ACAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-270 aa of BC018543 Sequence: RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG Predict reactive species
Full Name: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
Calculated Molecular Weight: 740 aa, 82 kDa
Observed Molecular Weight: 82-85 kDa
GenBank Accession Number: BC018543
Gene Symbol: ACAP1
Gene ID (NCBI): 9744
RRID: AB_3670714
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q15027
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924