Iright
BRAND / VENDOR: Proteintech

Proteintech, 82979-1-RR, ARID1B Recombinant monoclonal antibody

CATALOG NUMBER: 82979-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ARID1B (82979-1-RR) by Proteintech is a Recombinant antibody targeting ARID1B in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82979-1-RR targets ARID1B in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30643 Product name: Recombinant human ARID1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1370-1508 aa of NM_017519 Sequence: PAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWPSHVSQRQP Predict reactive species Full Name: AT rich interactive domain 1B (SWI1-like) Calculated Molecular Weight: 236 kDa GenBank Accession Number: NM_017519 Gene Symbol: ARID1B Gene ID (NCBI): 57492 RRID: AB_3670727 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NFD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924