Proteintech, 82985-1-RR, ADAMDEC1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ADAMDEC1 (82985-1-RR) by Proteintech is a Recombinant antibody targeting ADAMDEC1 in WB, ELISA applications with reactivity to Human samples 82985-1-RR targets ADAMDEC1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) was first identified as a unique member of the matrix metalloprotease (ADAM) family. ADAMs are increasingly recognized as playing an important role in gut homeostasis and bowel inflammation. ADAMDEC1 is abundantly, and almost exclusively, expressed in the gastrointestinal (GI) tract. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12265 Product name: Recombinant human ADAMDEC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-470 aa of BC074877 Sequence: REIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE Predict reactive species Full Name: ADAM-like, decysin 1 Calculated Molecular Weight: 470 aa, 53 kDa Observed Molecular Weight: 48-53 kDa GenBank Accession Number: BC074877 Gene Symbol: ADAMDEC1 Gene ID (NCBI): 27299 RRID: AB_3670735 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.