Proteintech, 82989-6-RR, Hif-1 alpha Recombinant monoclonal antibody

Size: 20ul / 100ul The Hif-1 alpha (82989-6-RR) by Proteintech is a Recombinant antibody targeting Hif-1 alpha in IHC, IF/ICC, ELISA applications with reactivity to mouse samples 82989-6-RR targets Hif-1 alpha in IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Cobalt Chloride treated NIH/3T3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information HIF1a, the major regulator of the cellular responses to hypoxia, consists of an oxygen-sensitive subunit, HIF1 alpha (HIF1A), and an oxygen-insensitive subunit, HIF1 beta (arylhydrocarbon receptor nuclear transporter [ARNT]). Under normal oxygen conditions, HIF1a is continuously produced and destroyed, in a process involving hydroxylation, interaction with von Hippel-Lindau (VHL) protein, polyubiquitylation and subsequent proteasomal degradation. Under hypoxic conditions, hydroxylation is impaired and HIF1a is stabilized. HIF1a localizes in cytoplasm in normoxia, but it can translocate into nuclear in response to hypoxia Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33620 Product name: Recombinant mouse Hif1a protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-825 aa of NM_001313919 Sequence: SEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATATTTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQG* Predict reactive species Full Name: hypoxia inducible factor 1, alpha subunit Calculated Molecular Weight: 93 kDa GenBank Accession Number: NM_001313919 Gene Symbol: Hif1a Gene ID (NCBI): 15251 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.