Iright
BRAND / VENDOR: Proteintech

Proteintech, 83026-5-RR, ACVR1B Recombinant monoclonal antibody

CATALOG NUMBER: 83026-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ACVR1B (83026-5-RR) by Proteintech is a Recombinant antibody targeting ACVR1B in IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83026-5-RR targets ACVR1B in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IF/ICC detected in: NIH/3T3 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ACVR1B (ALK4, activin A receptor type 1B) is a transforming growth factor-beta (TGF-beta) superfamily member (PMID: 37020544). A potential role for ACVR1B in regulating muscle mass is that it is part of the transforming growth factor b (TGFb) pathway regulating myostatin (PMID: 21063444). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0129 Product name: Recombinant human ACVR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-448 aa of BC000254 Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC Predict reactive species Full Name: activin A receptor, type IB Calculated Molecular Weight: 57 kDa GenBank Accession Number: BC000254 Gene Symbol: ACVR1B Gene ID (NCBI): 91 RRID: AB_3670765 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36896 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924