Iright
BRAND / VENDOR: Proteintech

Proteintech, 83056-4-RR, EPOR Recombinant monoclonal antibody

CATALOG NUMBER: 83056-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EPOR (83056-4-RR) by Proteintech is a Recombinant antibody targeting EPOR in IF/ICC, ELISA applications with reactivity to human samples 83056-4-RR targets EPOR in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: TF-1 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Erythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2/STAT5, PI3K/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33956 Product name: Recombinant human EPOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-250 aa of NM_000121.4 Sequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP Predict reactive species Full Name: erythropoietin receptor Calculated Molecular Weight: 55 kDa GenBank Accession Number: NM_000121.4 Gene Symbol: EPOR Gene ID (NCBI): 2057 RRID: AB_3670782 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924