Iright
BRAND / VENDOR: Proteintech

Proteintech, 83093-2-RR, PCP4L1 Recombinant monoclonal antibody

CATALOG NUMBER: 83093-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PCP4L1 (83093-2-RR) by Proteintech is a Recombinant antibody targeting PCP4L1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83093-2-RR targets PCP4L1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: Caco-2 cells Positive FC (Intra) detected in: Caco-2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PCP4L1 (Purkinje cell protein 4-like 1) is a small neuronal IQ motif protein closely related to the calmodulin-binding protein Pcp4/PEP-19 (PMID: 22458599). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31230 Product name: Recombinant human PCP4L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-68 aa of BC028905 Sequence: MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS Predict reactive species Full Name: Purkinje cell protein 4 like 1 Calculated Molecular Weight: 68 aa, 7 kDa GenBank Accession Number: BC028905 Gene Symbol: PCP4L1 Gene ID (NCBI): 654790 RRID: AB_3670807 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A6NKN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924