Iright
BRAND / VENDOR: Proteintech

Proteintech, 83096-1-RR, SHBG Recombinant monoclonal antibody

CATALOG NUMBER: 83096-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SHBG (83096-1-RR) by Proteintech is a Recombinant antibody targeting SHBG in WB, FC (Intra), ELISA applications with reactivity to human samples 83096-1-RR targets SHBG in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SHBG (sex hormone-binding globulin), also known as androgen-binding protein (ABP), is the specific transport protein for sex steroid hormones in humans. SHBG is synthesized mainly by the liver and circulates in the blood, in form of homodimer with a single steroid-binding site per dimer. In addition to the plasma SHBG, a testis isoform expressed by Sortoli cells also exists due to the gene alternative splicing. Various bands (44-56 kDa) recognized by this antibody may represent variably glycosylated or different isoforms of SHBG. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0369 Product name: Recombinant Human SHBG protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 30-402 aa of BC101785 Sequence: LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH Predict reactive species Full Name: sex hormone-binding globulin Calculated Molecular Weight: 402 aa, 44 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC101785 Gene Symbol: SHBG Gene ID (NCBI): 6462 RRID: AB_3670810 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04278 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924