Iright
BRAND / VENDOR: Proteintech

Proteintech, 83100-1-RR, PCYT1A Recombinant monoclonal antibody

CATALOG NUMBER: 83100-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PCYT1A (83100-1-RR) by Proteintech is a Recombinant antibody targeting PCYT1A in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83100-1-RR targets PCYT1A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, NIH/3T3 cells, mouse testis tissue, mouse brain tissue Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species Full Name: phosphate cytidylyltransferase 1, choline, alpha Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 38-41 kDa GenBank Accession Number: NM_005017 Gene Symbol: PCYT1A Gene ID (NCBI): 5130 RRID: AB_3670813 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49585 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924