Proteintech, 83105-6-RR, CEACAM8/CD66b Recombinant monoclonal antibody

Size: 20ul / 100ul The CEACAM8/CD66b (83105-6-RR) by Proteintech is a Recombinant antibody targeting CEACAM8/CD66b in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 83105-6-RR targets CEACAM8/CD66b in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva, human peripheral blood leukocyte Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Transfected CHO-K1 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), also known as CD66b, CGM6 or NCA-95, is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAM8 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes (PMID: 8104998; 18056392). It is involved in regulating adhesion and activation of eosinophils (PMID: 18056392). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg32133 Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 35-319 aa of BC026263 Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 8 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 95-100kDa GenBank Accession Number: BC026263 Gene Symbol: CEACAM8 Gene ID (NCBI): 1088 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P31997 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.