Iright
BRAND / VENDOR: Proteintech

Proteintech, 83155-4-RR, HOXB6 Recombinant monoclonal antibody

CATALOG NUMBER: 83155-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HOXB6 (83155-4-RR) by Proteintech is a Recombinant antibody targeting HOXB6 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83155-4-RR targets HOXB6 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells, A431 cells Positive FC (Intra) detected in: K562 Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information HOXB6 is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14189 Product name: Recombinant human HOXB6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC014651 Sequence: MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLE Predict reactive species Full Name: homeobox B6 Calculated Molecular Weight: 224 aa, 25 kDa GenBank Accession Number: BC014651 Gene Symbol: HOXB6 Gene ID (NCBI): 3216 RRID: AB_3670849 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P17509 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924