Iright
BRAND / VENDOR: Proteintech

Proteintech, 83160-2-RR, IFI35 Recombinant monoclonal antibody

CATALOG NUMBER: 83160-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IFI35 (83160-2-RR) by Proteintech is a Recombinant antibody targeting IFI35 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83160-2-RR targets IFI35 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A549 cells, HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IFI35 (interferon induced protein 35), also known as IFP35. It is expected to be located in cytoplasm, nucleus and extracellular space. The protein is expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. And the calculated molecular weight of IFI35 is 31 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34653 Product name: Recombinant human IFI35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-203 aa of BC001356 Sequence: RKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVP Predict reactive species Full Name: interferon-induced protein 35 Calculated Molecular Weight: 31 kDa GenBank Accession Number: BC001356 Gene Symbol: IFI35 Gene ID (NCBI): 3430 RRID: AB_3670853 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P80217 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924