Iright
BRAND / VENDOR: Proteintech

Proteintech, 83195-5-RR, SLC6A12 Recombinant monoclonal antibody

CATALOG NUMBER: 83195-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SLC6A12 (83195-5-RR) by Proteintech is a Recombinant antibody targeting SLC6A12 in WB, ELISA applications with reactivity to Human samples 83195-5-RR targets SLC6A12 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, MCF-7 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18778 Product name: Recombinant human SLC6A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 548-614 aa of BC126215 Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 Calculated Molecular Weight: 614 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC126215 Gene Symbol: SLC6A12 Gene ID (NCBI): 6539 RRID: AB_3670885 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P48065 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924