Proteintech, 83204-2-RR, HAS2 Recombinant monoclonal antibody

Size: 20ul / 100ul The HAS2 (83204-2-RR) by Proteintech is a Recombinant antibody targeting HAS2 in WB, ELISA applications with reactivity to human, mouse samples 83204-2-RR targets HAS2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HCT 116 cells, HT-29 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information RIT2 (Hyaluronan synthase 2) is a member of the gene family encoding the hyaluronan synthase 2, which can generate high-molecular-weight hyaluronan (HMW-HA) (PMID: 35069543). HAS2 is the most critical synthase in producing hyaluronan and is well known for its involvement in cancer growth, metabolism and metastasis (PMID: 36386154). HAS2 is involved in cellular acquired resistance to drug therapy in BrCa. HAS2 expression was decreased in the endocrine-resistant ER+BrCa cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34945 Product name: Recombinant human HAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-170 aa of BC069353 Sequence: EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQH Predict reactive species Full Name: hyaluronan synthase 2 Calculated Molecular Weight: 552 aa, 64 kDa Observed Molecular Weight: 63-67 kDa GenBank Accession Number: BC069353 Gene Symbol: HAS2 Gene ID (NCBI): 3037 RRID: AB_3670892 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92819 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.