Proteintech, 83217-5-RR, NUDCD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The NUDCD2 (83217-5-RR) by Proteintech is a Recombinant antibody targeting NUDCD2 in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 83217-5-RR targets NUDCD2 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, HepG2 cells, U-251 cells Positive IP detected in: HepG2 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NUDCD2, also known as NudCL2, is an HSP90 cochaperone that regulates sister chromatid cohesion during mitosis. NUDCD2 also plays a role in ciliogenesis(PMID: 30368549, 34480124). NUDCD2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone(PMID: 20133715). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15579 Product name: Recombinant human NUDCD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC017934 Sequence: MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK Predict reactive species Full Name: NudC domain containing 2 Calculated Molecular Weight: 157 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC017934 Gene Symbol: NUDCD2 Gene ID (NCBI): 134492 RRID: AB_3670903 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8WVJ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.