Iright
BRAND / VENDOR: Proteintech

Proteintech, 83238-3-RR, SOX8 Recombinant monoclonal antibody

CATALOG NUMBER: 83238-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SOX8 (83238-3-RR) by Proteintech is a Recombinant antibody targeting SOX8 in IF/ICC, IF-P, ELISA applications with reactivity to human samples 83238-3-RR targets SOX8 in IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34395 Product name: Recombinant human SOX8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 298-446 aa of BC031797 Sequence: EPGQAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGDQPRGSPDYGSCSGQSSATPAAPAGPFAGSQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSPRRPYASPLLNGLALPPAHSPTSHWDQPVYTTLTRP Predict reactive species Full Name: SRY (sex determining region Y)-box 8 Calculated Molecular Weight: 446 aa, 47 kDa GenBank Accession Number: BC031797 Gene Symbol: SOX8 Gene ID (NCBI): 30812 RRID: AB_3670914 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P57073 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924