Iright
BRAND / VENDOR: Proteintech

Proteintech, 83241-1-RR, Glypican 2 Recombinant monoclonal antibody

CATALOG NUMBER: 83241-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Glypican 2 (83241-1-RR) by Proteintech is a Recombinant antibody targeting Glypican 2 in ELISA applications with reactivity to human samples 83241-1-RR targets Glypican 2 in ELISA applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: SH-SY5Y cells, HeLa cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GPC2 (glypican 2), which is expected to be located in cell membrane and extracellular space. It is expressed in lymphoid tissue, skin and testis. The calculated molecular weight of the protein is 62 kDa. GPC2 is mainly active in growing nervous tissues and thyroid cancer tissues (PMID: 28616017). It participates in the growth and differentiation of neuronal axons. Increasing evidence has demonstrated the overexpression of GPC2 in neuroblastoma, a kind of childhood cancer. There is a discovery that GPC2 can be employed as a diagnostic, prognostic, and immunological predictor of generalized cancers. The study may broaden the train of thought toward application of GPC2 in immunotherapy (PMID: 35345673). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Affinity: K D <1.00 x 10 -12 M K Off <1.00 x 10 -6 M K On =1.07 x 10 5 M Immunogen: CatNo: Ag4041 Product name: Recombinant human GPC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC027972 Sequence: MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQ Predict reactive species Full Name: glypican 2 Calculated Molecular Weight: 579 aa, 63 kDa Observed Molecular Weight: 62,70-100 kDa GenBank Accession Number: BC027972 Gene Symbol: GPC2 Gene ID (NCBI): 221914 RRID: AB_3670917 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924