Proteintech, 83246-6-RR, APCDD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The APCDD1 (83246-6-RR) by Proteintech is a Recombinant antibody targeting APCDD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 83246-6-RR targets APCDD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, Raji cells, HEK-293T cells, HeLa cells, MCF-7 cells, mouse brain tissue, rat brain tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information APCDD1(adenomatosis polyposis coli down-regulated 1) is a membrane-bound glycoprotein conserved during vertebrate evolution that regulates important biological processes controlled by Wnt signaling (PMID: 26170146). APCDD1 is a membrane-bound glycoprotein that is abundantly expressed in human HFs (hair follicles) and can interact in vitro with WNT3A and LRP5, two essential components of Wnt signaling (PMID: 20393562). APCDD1 may be modified by glycosylation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10303 Product name: Recombinant human APCDD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 141-496 aa of BC053324 Sequence: TEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPGRHTWSL Predict reactive species Full Name: adenomatosis polyposis coli down-regulated 1 Calculated Molecular Weight: 514 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC053324 Gene Symbol: APCDD1 Gene ID (NCBI): 147495 RRID: AB_3670921 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8J025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.