Iright
BRAND / VENDOR: Proteintech

Proteintech, 83251-2-RR, NRG1, isoform Alpha Recombinant monoclonal antibody

CATALOG NUMBER: 83251-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NRG1, isoform Alpha (83251-2-RR) by Proteintech is a Recombinant antibody targeting NRG1, isoform Alpha in IF/ICC, IF-P, ELISA applications with reactivity to human samples 83251-2-RR targets NRG1, isoform Alpha in IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF-P detected in: rat brain tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Neuregulin 1 (NRG1) is a trophic factor that has been implicated in neural development, neurotransmission, and synaptic plasticity. NRG1 has multiple isoforms that are generated by usage of different promoters and alternative splicing of a single gene. NRG1 and its receptor ErbB tyrosine kinase are expressed not only in the developing nervous system, but also in the adult brain. The immunogen of this antibody is against NRG1 isoform Alpha. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species Full Name: neuregulin 1 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC007675 Gene Symbol: NRG1 Gene ID (NCBI): 3084 RRID: AB_3670926 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q02297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924